PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G118900.1
Common NameB456_004G118900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 192aa    MW: 21511.4 Da    PI: 7.587
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G118900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-131562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd++l++ v ++G  +W++++   g+ R +k+c++rw +yl
  Gorai.004G118900.1 15 KGLWSPEEDLKLKNSVLKHGHFCWSSVPINAGLQRNGKSCRLRWINYL 62
                        678*****************99************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.6931066IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-201065IPR009057Homeodomain-like
SMARTSM007171.1E-91464IPR001005SANT/Myb domain
PfamPF002495.7E-121562IPR001005SANT/Myb domain
SuperFamilySSF466892.61E-191792IPR009057Homeodomain-like
CDDcd001672.93E-91862No hitNo description
Gene3DG3DSA:1.10.10.602.5E-86693IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGCRPCEKPK AKHRKGLWSP EEDLKLKNSV LKHGHFCWSS VPINAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FTPQEDDAIL SLHHLLGNKI AKVENVEAQH TSSTSESSVL PQNLTDQSAS  120
FATDQAVPMH FDLPQRSPLP KLLFAEWLSL DEEGGRFGTD LQDLLNDASV NQLFKFESQI  180
SGNDFIGSKW E*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038672.13e-80Myb domain protein 18, putative
TrEMBLA0A0D2R3621e-141A0A0D2R362_G
STRINGPOPTR_0015s13190.19e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.16e-40myb domain protein 45
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]